PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.95ZZJ
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family TALE
Protein Properties Length: 240aa    MW: 27732.4 Da    PI: 6.3652
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.95ZZJgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.27.4e-101702042155
                  HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
     Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                  k +yps+++++ LA+++gL+ +q+ +WF N+R ++
  Araip.95ZZJ 170 KWPYPSESQKQALAESTGLDLKQINNWFINQRKRH 204
                  569*****************************885 PP

2ELK34.64e-12124145122
          ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                  ELK qLl+KYsgyLg+Lk+EF+
  Araip.95ZZJ 124 ELKIQLLKKYSGYLGGLKKEFL 145
                  9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012566.6E-232980IPR005541KNOX2
PfamPF037913.5E-203278IPR005541KNOX2
PfamPF037894.4E-9124145IPR005539ELK domain
PROSITE profilePS5121310.737124144IPR005539ELK domain
SMARTSM011885.5E-6124145IPR005539ELK domain
PROSITE profilePS5007112.228144207IPR001356Homeobox domain
SuperFamilySSF466891.2E-19146218IPR009057Homeodomain-like
SMARTSM003892.8E-12146211IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.5E-28149210IPR009057Homeodomain-like
CDDcd000866.96E-13156208No hitNo description
PfamPF059201.8E-17164203IPR008422Homeobox KN domain
PROSITE patternPS000270182205IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
VGAPPEVVGR LEELCGKCSS SSSSRRSDSN SCIGEDPGLD QFMEAYCEML IKYEQEISKP  60
FKEAMLFFST IDSQLKALSL SPHFGTNHQS ESSSSLLQNE VDVLDENNNN NRNMDTSQAE  120
EDRELKIQLL KKYSGYLGGL KKEFLKKKKN GKLPKEARQQ LLDWWNRHYK WPYPSESQKQ  180
ALAESTGLDL KQINNWFINQ RKRHWKPSED MQFAVMDATN HYMETIMCKP FPMDTMPILF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016165672.10.0PREDICTED: homeobox protein knotted-1-like LET6
RefseqXP_015973573.10.0PREDICTED: homeobox protein knotted-1-like LET6
SwissprotP466083e-95HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLA0A151TVC91e-115A0A151TVC9_CAJCA; Homeobox protein SBH1
STRINGGLYMA14G05150.21e-113(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.13e-72KNOX/ELK homeobox transcription factor